SCOP 1.61: Domain d1h8ed1: 1h8e D:358-475

Lineage for d1h8ed1 (1h8e D:358-475)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.69: Left-handed superhelix [47916] (3 superfamilies)

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)

6. Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)

8. Domain d1h8ed1: 1h8e D:358-475 [60747]
   Other proteins in same PDB: d1h8ea2, d1h8ea3, d1h8eb2, d1h8eb3, d1h8ec2, d1h8ec3, d1h8ed2, d1h8ed3, d1h8ee2, d1h8ee3, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_

Details for d1h8ed1

PDB Entry: 1h8e, 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)

SCOP Domain Sequences for d1h8ed1:

Sequence; same for both SEQRES and ATOM records:

>d1h8ed1 a.69.1.1 (D:358-475) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae

Timeline for d1h8ed1:

• d1h8ed1 first appeared in SCOP 1.57
  
• d1h8ed1 appears in SCOP 1.59
  
• d1h8ed1 appears in SCOP 1.63
  
• d1h8ed1 appears in the current release, SCOPe 2.08