Lineage for d1h8ec1 (1h8e C:380-510)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1091605Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1091606Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 1091607Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 1091608Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 1091611Species Cow (Bos taurus) [TaxId:9913] [88893] (14 PDB entries)
    Uniprot P19483
  8. 1091629Domain d1h8ec1: 1h8e C:380-510 [60744]
    Other proteins in same PDB: d1h8ea2, d1h8ea3, d1h8eb2, d1h8eb3, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ed3, d1h8ee1, d1h8ee2, d1h8ee3, d1h8ef1, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_
    complexed with adp, alf, gol, mg, so4

Details for d1h8ec1

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)
PDB Compounds: (C:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1h8ec1:

Sequence, based on SEQRES records: (download)

>d1h8ec1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Sequence, based on observed residues (ATOM records): (download)

>d1h8ec1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafadldaatqqllsrgvrltellkqgqyspmaieeqva
viyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklkeivtn
flagfea

SCOPe Domain Coordinates for d1h8ec1:

Click to download the PDB-style file with coordinates for d1h8ec1.
(The format of our PDB-style files is described here.)

Timeline for d1h8ec1: