Lineage for d1h8ec1 (1h8e C:380-510)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282945Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 282946Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 282947Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 282948Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 282951Species Cow (Bos taurus) [TaxId:9913] [88893] (10 PDB entries)
  8. 282957Domain d1h8ec1: 1h8e C:380-510 [60744]
    Other proteins in same PDB: d1h8ea2, d1h8ea3, d1h8eb2, d1h8eb3, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ed3, d1h8ee1, d1h8ee2, d1h8ee3, d1h8ef1, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_
    complexed with adp, alf, gol, mg, so4

Details for d1h8ec1

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)

SCOP Domain Sequences for d1h8ec1:

Sequence, based on SEQRES records: (download)

>d1h8ec1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Sequence, based on observed residues (ATOM records): (download)

>d1h8ec1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafadldaatqqllsrgvrltellkqgqyspmaieeqva
viyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklkeivtn
flagfea

SCOP Domain Coordinates for d1h8ec1:

Click to download the PDB-style file with coordinates for d1h8ec1.
(The format of our PDB-style files is described here.)

Timeline for d1h8ec1: