Lineage for d1h8ea1 (1h8e A:380-510)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99041Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
  4. 99042Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 99043Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 99044Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 99048Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)
  8. 99055Domain d1h8ea1: 1h8e A:380-510 [60738]
    Other proteins in same PDB: d1h8ea2, d1h8ea3, d1h8eb2, d1h8eb3, d1h8ec2, d1h8ec3, d1h8ed2, d1h8ed3, d1h8ee2, d1h8ee3, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_

Details for d1h8ea1

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)

SCOP Domain Sequences for d1h8ea1:

Sequence, based on SEQRES records: (download)

>d1h8ea1 a.69.1.1 (A:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Sequence, based on observed residues (ATOM records): (download)

>d1h8ea1 a.69.1.1 (A:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafldaatqqllsrgvrltellkqgqyspmaieeqvavi
yagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklkeivtnfl
agfea

SCOP Domain Coordinates for d1h8ea1:

Click to download the PDB-style file with coordinates for d1h8ea1.
(The format of our PDB-style files is described here.)

Timeline for d1h8ea1: