Class a: All alpha proteins [46456] (151 folds) |
Fold a.69: Left-handed superhelix [47916] (3 superfamilies) |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein) |
Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries) |
Domain d1h8ea1: 1h8e A:380-510 [60738] Other proteins in same PDB: d1h8ea2, d1h8ea3, d1h8eb2, d1h8eb3, d1h8ec2, d1h8ec3, d1h8ed2, d1h8ed3, d1h8ee2, d1h8ee3, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_ |
PDB Entry: 1h8e (more details), 2 Å
SCOP Domain Sequences for d1h8ea1:
Sequence, based on SEQRES records: (download)
>d1h8ea1 a.69.1.1 (A:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke ivtnflagfea
>d1h8ea1 a.69.1.1 (A:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} tramkqvagtmklelaqyrevaafldaatqqllsrgvrltellkqgqyspmaieeqvavi yagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklkeivtnfl agfea
Timeline for d1h8ea1: