SCOPe 2.03: Domain d1h5bd_: 1h5b D:

Lineage for d1h5bd_ (1h5b D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries)

8. Domain d1h5bd_: 1h5b D: [60641]
   AV11S5-AJ17
   complexed with cl, gol

Details for d1h5bd_

PDB Entry: 1h5b, 1.85 Å

PDB Description: t cell receptor valpha11 (av11s5) domain

PDB Compounds: (D:) murine t cell receptor (tcr) valpha domain

SCOPe Domain Sequences for d1h5bd_:

Sequence; same for both SEQRES and ATOM records:

>d1h5bd_ b.1.1.1 (D:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
safdskerrystlhirdaqledsgtyfcaaeassgawqlifgsgtqltvmp

Timeline for d1h5bd_:

• d1h5bd_ first appeared in SCOP 1.57
  
• d1h5bd_ appears in SCOPe 2.02
  
• d1h5bd_ appears in SCOPe 2.04
  
• d1h5bd_ appears in the current release, SCOPe 2.08