Lineage for d1h5bc_ (1h5b C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 548189Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 548226Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (16 PDB entries)
  8. 548229Domain d1h5bc_: 1h5b C: [60640]

Details for d1h5bc_

PDB Entry: 1h5b (more details), 1.85 Å

PDB Description: t cell receptor valpha11 (av11s5) domain

SCOP Domain Sequences for d1h5bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5bc_ b.1.1.1 (C:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
safdskerrystlhirdaqledsgtyfcaaeassgswqlifgsgtqltvmpvt

SCOP Domain Coordinates for d1h5bc_:

Click to download the PDB-style file with coordinates for d1h5bc_.
(The format of our PDB-style files is described here.)

Timeline for d1h5bc_: