Lineage for d1h5bb_ (1h5b B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 653994Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 654042Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (17 PDB entries)
  8. 654044Domain d1h5bb_: 1h5b B: [60639]

Details for d1h5bb_

PDB Entry: 1h5b (more details), 1.85 Å

PDB Description: t cell receptor valpha11 (av11s5) domain
PDB Compounds: (B:) murine t cell receptor (tcr) valpha domain

SCOP Domain Sequences for d1h5bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5bb_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
safdskerrystlhirdaqledsgtyfcaaeassgawqlifgsgtqltvmp

SCOP Domain Coordinates for d1h5bb_:

Click to download the PDB-style file with coordinates for d1h5bb_.
(The format of our PDB-style files is described here.)

Timeline for d1h5bb_: