Lineage for d1h5ba_ (1h5b A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 158716Protein T-cell antigen receptor [48933] (6 species)
  7. 158747Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (14 PDB entries)
  8. 158748Domain d1h5ba_: 1h5b A: [60638]

Details for d1h5ba_

PDB Entry: 1h5b (more details), 1.85 Å

PDB Description: t cell receptor valpha11 (av11s5) domain

SCOP Domain Sequences for d1h5ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
safdserarystlhirdaqledsgtyfcaaeassgswqlifgsgtqltvmpvt

SCOP Domain Coordinates for d1h5ba_:

Click to download the PDB-style file with coordinates for d1h5ba_.
(The format of our PDB-style files is described here.)

Timeline for d1h5ba_: