Lineage for d1h54b2 (1h54 B:1-268)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781894Family b.30.5.3: Glycosyltransferase family 36 N-terminal domain [63733] (2 proteins)
    overall domain organization is similar to Bacterial glucoamylase
  6. 2781900Protein Lactobacillus maltose phosphorylase, N-terminal domain [63734] (1 species)
  7. 2781901Species Lactobacillus brevis [TaxId:1580] [63735] (1 PDB entry)
  8. 2781903Domain d1h54b2: 1h54 B:1-268 [60637]
    Other proteins in same PDB: d1h54a1, d1h54a3, d1h54b1, d1h54b3
    complexed with k, po4

Details for d1h54b2

PDB Entry: 1h54 (more details), 2.15 Å

PDB Description: Maltose phosphorylase from Lactobacillus brevis
PDB Compounds: (B:) maltose phosphorylase

SCOPe Domain Sequences for d1h54b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h54b2 b.30.5.3 (B:1-268) Lactobacillus maltose phosphorylase, N-terminal domain {Lactobacillus brevis [TaxId: 1580]}
mkrifevqpwnvithtfdpkdkrlqesmtslgngymgmrgdfeegysgdslqgiylggvw
ypdktrvgwwkngypkyfgkvvnavnfiklpieingepvdlakdkisdftldldmhqgvl
nrsfvvergavrvalnfqrflsvaqpelsvqkvtvknlsdaevdvtlkpsidadvmneea
nyderfwdvlatdqqadrgsivakttpnpfgtprftsgmemrlvtdlknvaitqpnekev
ttaytgklapqasaelekrvivvtsrdy

SCOPe Domain Coordinates for d1h54b2:

Click to download the PDB-style file with coordinates for d1h54b2.
(The format of our PDB-style files is described here.)

Timeline for d1h54b2: