Lineage for d1h53a_ (1h53 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597438Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 597439Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulfide-rich
  5. 597440Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 597458Protein Angiogenin [54094] (2 species)
  7. 597462Species Human (Homo sapiens) [TaxId:9606] [54095] (19 PDB entries)
  8. 597468Domain d1h53a_: 1h53 A: [60633]
    complexed with cit, po4; mutant

Details for d1h53a_

PDB Entry: 1h53 (more details), 2 Å

PDB Description: binding of phosphate and pyrophosphate ions at the active site of human angiogenin as revealed by x-ray crystallography

SCOP Domain Sequences for d1h53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h53a_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens)}
nsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkng
nphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldgsifrr
p

SCOP Domain Coordinates for d1h53a_:

Click to download the PDB-style file with coordinates for d1h53a_.
(The format of our PDB-style files is described here.)

Timeline for d1h53a_: