SCOPe 2.06: Domain d1h4jh_: 1h4j H:

Lineage for d1h4jh_ (1h4j H:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail
   automatically mapped to Pfam PF02315

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)

6. Protein Methanol dehydrogenase, light chain [48668] (3 species)

7. Species Methylobacterium extorquens [TaxId:408] [63633] (3 PDB entries)
   Uniprot P14775

8. Domain d1h4jh_: 1h4j H: [60597]
   Other proteins in same PDB: d1h4ja_, d1h4jc_, d1h4je_, d1h4jg_
   complexed with ca, pqq; mutant

Details for d1h4jh_

PDB Entry: 1h4j, 3 Å

PDB Description: methylobacterium extorquens methanol dehydrogenase d303e mutant

PDB Compounds: (H:) methanol dehydrogenase subunit 2

SCOPe Domain Sequences for d1h4jh_:

Sequence; same for both SEQRES and ATOM records:

>d1h4jh_ a.137.2.1 (H:) Methanol dehydrogenase, light chain {Methylobacterium extorquens [TaxId: 408]}
ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
tgkfeydvakis

Timeline for d1h4jh_:

• d1h4jh_ first appeared in SCOP 1.57
  
• d1h4jh_ appears in SCOPe 2.05
  
• d1h4jh_ appears in SCOPe 2.07
  
• d1h4jh_ appears in the current release, SCOPe 2.08