Lineage for d1h4jf_ (1h4j F:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51411Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (8 superfamilies)
  4. 51418Superfamily a.137.2: Quinoprotein alcohol dehydrogenase [48666] (1 family) (S)
  5. 51419Family a.137.2.1: Quinoprotein alcohol dehydrogenase [48667] (1 protein)
  6. 51420Protein Methanol dehydrogenase, light chain [48668] (2 species)
  7. 51421Species Methylobacterium extorquens [TaxId:408] [63633] (2 PDB entries)
  8. 51426Domain d1h4jf_: 1h4j F: [60595]
    Other proteins in same PDB: d1h4ja_, d1h4jc_, d1h4je_, d1h4jg_

Details for d1h4jf_

PDB Entry: 1h4j (more details), 3 Å

PDB Description: methylobacterium extorquens methanol dehydrogenase d303e mutant

SCOP Domain Sequences for d1h4jf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4jf_ a.137.2.1 (F:) Methanol dehydrogenase, light chain {Methylobacterium extorquens}
ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
tgkfeydvakis

SCOP Domain Coordinates for d1h4jf_:

Click to download the PDB-style file with coordinates for d1h4jf_.
(The format of our PDB-style files is described here.)

Timeline for d1h4jf_: