Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) consists of single alpha-helix and irregular N-terminal tail automatically mapped to Pfam PF02315 |
Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins) |
Protein Methanol dehydrogenase, light chain [48668] (3 species) |
Species Methylobacterium extorquens [TaxId:408] [63633] (3 PDB entries) Uniprot P14775 |
Domain d1h4jd_: 1h4j D: [60593] Other proteins in same PDB: d1h4ja_, d1h4jc_, d1h4je_, d1h4jg_ complexed with ca, pqq; mutant |
PDB Entry: 1h4j (more details), 3 Å
SCOPe Domain Sequences for d1h4jd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4jd_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylobacterium extorquens [TaxId: 408]} ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk tgkfeydvakis
Timeline for d1h4jd_: