SCOPe 2.01: Domain d1h4id_: 1h4i D:

Lineage for d1h4id_ (1h4i D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)

6. Protein Methanol dehydrogenase, light chain [48668] (3 species)

7. Species Methylobacterium extorquens [TaxId:408] [63633] (3 PDB entries)
   Uniprot P14775

8. Domain d1h4id_: 1h4i D: [60589]
   Other proteins in same PDB: d1h4ia_, d1h4ic_
   complexed with ca, pqq

Details for d1h4id_

PDB Entry: 1h4i, 1.94 Å

PDB Description: methylobacterium extorquens methanol dehydrogenase

PDB Compounds: (D:) methanol dehydrogenase subunit 2

SCOPe Domain Sequences for d1h4id_:

Sequence; same for both SEQRES and ATOM records:

>d1h4id_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylobacterium extorquens [TaxId: 408]}
ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
tgkfeydvakisa

Timeline for d1h4id_:

• d1h4id_ first appeared in SCOP 1.57
  
• d1h4id_ appears in SCOP 1.75
  
• d1h4id_ appears in SCOPe 2.02
  
• d1h4id_ appears in the current release, SCOPe 2.08