Class a: All alpha proteins [46456] (226 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies) not a true fold |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) consists of single alpha-helix and irregular N-terminal tail |
Family a.137.2.1: Methanol dehydrogenase subunit [48667] (1 protein) |
Protein Methanol dehydrogenase, light chain [48668] (3 species) |
Species Methylobacterium extorquens [TaxId:408] [63633] (3 PDB entries) |
Domain d1h4id_: 1h4i D: [60589] Other proteins in same PDB: d1h4ia_, d1h4ic_ complexed with ca, pqq |
PDB Entry: 1h4i (more details), 1.94 Å
SCOP Domain Sequences for d1h4id_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4id_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylobacterium extorquens} ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk tgkfeydvakisa
Timeline for d1h4id_: