Lineage for d1giyx_ (1giy X:)

  1. Root: SCOP 1.59
  2. 146111Class i: Low resolution protein structures [58117] (16 folds)
  3. 146112Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 146113Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 146114Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 146115Protein 70S ribosome functional complex [58121] (2 species)
  7. 146143Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 146272Domain d1giyx_: 1giy X: [60571]

Details for d1giyx_

PDB Entry: 1giy (more details), 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix

SCOP Domain Sequences for d1giyx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1giyx_ i.1.1.1 (X:) 70S ribosome functional complex {Thermus thermophilus}
mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

SCOP Domain Coordinates for d1giyx_:

Click to download the PDB-style file with coordinates for d1giyx_.
(The format of our PDB-style files is described here.)

Timeline for d1giyx_: