SCOP 1.71: Domain d1giyw_: 1giy W:

Lineage for d1giyw_ (1giy W:)

1. Root: SCOP 1.71

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)

8. Domain d1giyw_: 1giy W: [60570]

Details for d1giyw_

PDB Entry: 1giy, 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix

SCOP Domain Sequences for d1giyw_:

Sequence, based on SEQRES records:

>d1giyw_ i.1.1.1 (W:) 70S ribosome functional complex {Thermus thermophilus}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Sequence, based on observed residues (ATOM records):

>d1giyw_ i.1.1.1 (W:) 70S ribosome functional complex {Thermus thermophilus}
tvlhvqeirdmtpaereaelddlktellnarvqaaggapenpgrikelrkaiariktiqg
eegd

Timeline for d1giyw_:

• d1giyw_ first appeared in SCOP 1.57
  
• d1giyw_ appears in SCOP 1.69
  
• d1giyw_ appears in SCOP 1.73
  
• d1giyw_ appears in the current release, SCOPe 2.08