SCOPe 2.02: Domain d1giyu_: 1giy U:

Lineage for d1giyu_ (1giy U:)

1. Root: SCOPe 2.02

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)

8. Domain d1giyu_: 1giy U: [60568]

Details for d1giyu_

PDB Entry: 1giy, 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix

PDB Compounds: (U:) 50S ribosomal protein L24

SCOPe Domain Sequences for d1giyu_:

Sequence, based on SEQRES records:

>d1giyu_ i.1.1.1 (U:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle

Sequence, based on observed residues (ATOM records):

>d1giyu_ i.1.1.1 (U:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
skqpdkqrksqrraplherhkqvratlsadlreeygvrvnagdtvevlrgdfageegevi
nvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle

Timeline for d1giyu_:

• d1giyu_ first appeared in SCOP 1.57
  
• d1giyu_ appears in SCOPe 2.01
  
• d1giyu_ appears in SCOPe 2.03
  
• d1giyu_ appears in the current release, SCOPe 2.08