| Class i: Low resolution protein structures [58117] (16 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
| Protein 70S ribosome functional complex [58121] (2 species) |
| Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries) |
| Domain d1giys_: 1giy S: [60566] |
PDB Entry: 1giy (more details), 5.5 Å
SCOP Domain Sequences for d1giys_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1giys_ i.1.1.1 (S:) 70S ribosome functional complex {Thermus thermophilus}
meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
Timeline for d1giys_: