Lineage for d1giyq_ (1giy Q:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3043115Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 3043222Domain d1giyq_: 1giy Q: [60564]

Details for d1giyq_

PDB Entry: 1giy (more details), 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix
PDB Compounds: (Q:) 50S ribosomal protein L18

SCOPe Domain Sequences for d1giyq_:

Sequence, based on SEQRES records: (download)

>d1giyq_ i.1.1.1 (Q:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
pmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlasahssdlae
ygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqegaidagld
i

Sequence, based on observed residues (ATOM records): (download)

>d1giyq_ i.1.1.1 (Q:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
pmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtpngddtlasahssdlaeyg
weptgsayltgllaglraqeagveeavldiglnsptpkvfaiqegaidagldi

SCOPe Domain Coordinates for d1giyq_:

Click to download the PDB-style file with coordinates for d1giyq_.
(The format of our PDB-style files is described here.)

Timeline for d1giyq_: