Lineage for d1giyi_ (1giy I:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896972Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 897113Domain d1giyi_: 1giy I: [60556]

Details for d1giyi_

PDB Entry: 1giy (more details), 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix
PDB Compounds: (I:) 50S ribosomal protein L7/L12

SCOP Domain Sequences for d1giyi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1giyi_ i.1.1.1 (I:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeektefd
vvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkklee
agaevelk

SCOP Domain Coordinates for d1giyi_:

Click to download the PDB-style file with coordinates for d1giyi_.
(The format of our PDB-style files is described here.)

Timeline for d1giyi_: