Lineage for d1giyh_ (1giy H:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1711001Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 1711091Domain d1giyh_: 1giy H: [60555]

Details for d1giyh_

PDB Entry: 1giy (more details), 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix
PDB Compounds: (H:) 50S ribosomal protein L6

SCOPe Domain Sequences for d1giyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1giyh_ i.1.1.1 (H:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
trsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegleievps
qtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrl

SCOPe Domain Coordinates for d1giyh_:

Click to download the PDB-style file with coordinates for d1giyh_.
(The format of our PDB-style files is described here.)

Timeline for d1giyh_: