Lineage for d1giyg_ (1giy G:)

  1. Root: SCOP 1.61
  2. 206238Class i: Low resolution protein structures [58117] (17 folds)
  3. 206239Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 206240Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 206241Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 206242Protein 70S ribosome functional complex [58121] (2 species)
  7. 206273Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 206385Domain d1giyg_: 1giy G: [60554]

Details for d1giyg_

PDB Entry: 1giy (more details), 5.5 Å

PDB Description: crystal structure of the ribosome at 5.5 a resolution. this file, 1giy, contains the 50s ribosome subunit. the 30s ribosome subunit, three trna, and mrna molecules are in the file 1gix

SCOP Domain Sequences for d1giyg_:

Sequence, based on SEQRES records: (download)

>d1giyg_ i.1.1.1 (G:) 70S ribosome functional complex {Thermus thermophilus}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhr

Sequence, based on observed residues (ATOM records): (download)

>d1giyg_ i.1.1.1 (G:) 70S ribosome functional complex {Thermus thermophilus}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hr

SCOP Domain Coordinates for d1giyg_:

Click to download the PDB-style file with coordinates for d1giyg_.
(The format of our PDB-style files is described here.)

Timeline for d1giyg_: