![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
![]() | Protein 70S ribosome functional complex [58121] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries) |
![]() | Domain d1gixr_: 1gix R: [60541] |
PDB Entry: 1gix (more details), 5.5 Å
SCOPe Domain Sequences for d1gixr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gixr_ i.1.1.1 (R:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d1gixr_: