![]() | Class i: Low resolution protein structures [58117] (17 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
![]() | Protein 70S ribosome functional complex [58121] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries) |
![]() | Domain d1gixo_: 1gix O: [60538] |
PDB Entry: 1gix (more details), 5.5 Å
SCOP Domain Sequences for d1gixo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gixo_ i.1.1.1 (O:) 70S ribosome functional complex {Thermus thermophilus} ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk pkea
Timeline for d1gixo_: