SCOPe 2.02: Domain d1gixk

Lineage for d1gixk_ (1gix K:)

Root: SCOPe 2.02
Class i: Low resolution protein structures [58117] (25 folds)
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)
Family i.1.1.1: Ribosome complexes [58120] (1 protein)
Protein 70S ribosome functional complex [58121] (9 species)
Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
Domain d1gixk_: 1gix K: [60534]

Details for d1gixk_

PDB Entry: 1gix (more details), 5.5 Å

PDB Description: Crystal structure of the ribosome at 5.5 A resolution. This file, 1GIX, contains the 30S ribosome subunit, three tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1GIY

PDB Compounds: (K:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1gixk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gixk_ i.1.1.1 (K:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d1gixk_:

Click to download the PDB-style file with coordinates for d1gixk_.
(The format of our PDB-style files is described here.)

Timeline for d1gixk_:

d1gixk_ first appeared in SCOP 1.57
d1gixk_ appears in SCOPe 2.01
d1gixk_ appears in SCOPe 2.03
d1gixk_ appears in the current release, SCOPe 2.08