Lineage for d1gixh_ (1gix H:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627637Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 627726Domain d1gixh_: 1gix H: [60531]

Details for d1gixh_

PDB Entry: 1gix (more details), 5.5 Å

PDB Description: Crystal structure of the ribosome at 5.5 A resolution. This file, 1GIX, contains the 30S ribosome subunit, three tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1GIY

SCOP Domain Sequences for d1gixh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gixh_ i.1.1.1 (H:) 70S ribosome functional complex {Thermus thermophilus}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
srnpiniayatmealrqlrtkadverlrkg

SCOP Domain Coordinates for d1gixh_:

Click to download the PDB-style file with coordinates for d1gixh_.
(The format of our PDB-style files is described here.)

Timeline for d1gixh_: