Lineage for d1gixf_ (1gix F:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 753712Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 753713Protein 70S ribosome functional complex [58121] (3 species)
  7. 754252Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 754334Domain d1gixf_: 1gix F: [60529]

Details for d1gixf_

PDB Entry: 1gix (more details), 5.5 Å

PDB Description: Crystal structure of the ribosome at 5.5 A resolution. This file, 1GIX, contains the 30S ribosome subunit, three tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1GIY
PDB Compounds: (F:) 30S ribosomal protein S3

SCOP Domain Sequences for d1gixf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gixf_ i.1.1.1 (F:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
idygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1gixf_:

Click to download the PDB-style file with coordinates for d1gixf_.
(The format of our PDB-style files is described here.)

Timeline for d1gixf_: