Lineage for d1ghpa_ (1ghp A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690477Protein beta-Lactamase, class A [56606] (16 species)
  7. 1690632Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries)
  8. 1690634Domain d1ghpa_: 1ghp A: [60520]
    complexed with pnm, so4; mutant

Details for d1ghpa_

PDB Entry: 1ghp (more details), 1.76 Å

PDB Description: structures of the acyl-enzyme complex of the staphylococcus aureus beta-lactamase mutant glu166asp:asn170gln with degraded benzylpenicillin
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d1ghpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghpa_ e.3.1.1 (A:) beta-Lactamase, class A {Staphylococcus aureus [TaxId: 1280]}
kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvrydielqyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef

SCOPe Domain Coordinates for d1ghpa_:

Click to download the PDB-style file with coordinates for d1ghpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ghpa_: