SCOPe 2.06: Domain d1ggwa_: 1ggw A:

Lineage for d1ggwa_ (1ggw A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Cdc4p [63543] (1 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [63544] (1 PDB entry)

8. Domain d1ggwa_: 1ggw A: [60490]

Details for d1ggwa_

PDB Entry: 1ggw

PDB Description: cdc4p from schizosaccharomyces pombe

PDB Compounds: (A:) protein (cdc4p)

SCOPe Domain Sequences for d1ggwa_:

Sequence; same for both SEQRES and ATOM records:

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
stddspykqafslfdrhgtgripktsigdllracgqnptlaeiteiestlpaevdmeqfl
qvlnrpngfdmpgdpeefvkgfqvfdkdatgmigvgelryvltslgeklsneemdellkg
vpvkdgmvnyhdfvqmilan

Timeline for d1ggwa_:

• d1ggwa_ first appeared in SCOP 1.57
  
• d1ggwa_ appears in SCOPe 2.05
  
• d1ggwa_ appears in SCOPe 2.07
  
• d1ggwa_ appears in the current release, SCOPe 2.08