Lineage for d1ge9a_ (1ge9 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1208357Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1208402Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) (S)
  5. 1208403Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 1208404Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 1208405Species Aquifex aeolicus [TaxId:63363] [64293] (1 PDB entry)
  8. 1208406Domain d1ge9a_: 1ge9 A: [60463]

Details for d1ge9a_

PDB Entry: 1ge9 (more details)

PDB Description: solution structure of the ribosome recycling factor
PDB Compounds: (A:) ribosome recycling factor

SCOPe Domain Sequences for d1ge9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ge9a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Aquifex aeolicus [TaxId: 63363]}
mikeledifkeaekdmkkaveyykneiaglrtsrastalveeikveyygskvpikqlgti
svpehnqiviqvwdqnavpaiekaireelnlnptvqgnvirvtlpplteerrrelvrllh
kiteearvrvrnvrreakemieelegisedekkralerlqkltdkyideinklmeakeke
imsv

SCOPe Domain Coordinates for d1ge9a_:

Click to download the PDB-style file with coordinates for d1ge9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ge9a_: