![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (3 superfamilies) core:alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) ![]() |
![]() | Family d.67.3.1: Ribosome recycling factor, RRF [55195] (1 protein) |
![]() | Protein Ribosome recycling factor, RRF [55196] (4 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [64293] (1 PDB entry) |
![]() | Domain d1ge9a_: 1ge9 A: [60463] |
PDB Entry: 1ge9 (more details)
SCOP Domain Sequences for d1ge9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ge9a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Aquifex aeolicus} mikeledifkeaekdmkkaveyykneiaglrtsrastalveeikveyygskvpikqlgti svpehnqiviqvwdqnavpaiekaireelnlnptvqgnvirvtlpplteerrrelvrllh kiteearvrvrnvrreakemieelegisedekkralerlqkltdkyideinklmeakeke imsv
Timeline for d1ge9a_: