Lineage for d1ge9a_ (1ge9 A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (3 superfamilies) 
Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) 
Family d.67.3.1: Ribosome recycling factor, RRF [55195] (1 protein) Protein Ribosome recycling factor, RRF [55196] (4 species) 
Species Aquifex aeolicus [TaxId:63363] [64293] (1 PDB entry) 
Domain d1ge9a_: 1ge9 A: [60463]
Details for d1ge9a_
PDB Entry: 1ge9 (more details)
PDB Description: solution structure of the ribosome recycling factor
SCOP Domain Sequences for d1ge9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ge9a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Aquifex aeolicus}
mikeledifkeaekdmkkaveyykneiaglrtsrastalveeikveyygskvpikqlgti
svpehnqiviqvwdqnavpaiekaireelnlnptvqgnvirvtlpplteerrrelvrllh
kiteearvrvrnvrreakemieelegisedekkralerlqkltdkyideinklmeakeke
imsv
SCOP Domain Coordinates for d1ge9a_:
Click to download the PDB-style file with coordinates for d1ge9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ge9a_:
- d1ge9a_ first appeared in SCOP 1.57
- d1ge9a_ appears in SCOP 1.61
- d1ge9a_ appears in the current release, SCOPe 2.08
View in 3D