Lineage for d1ge7b_ (1ge7 B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82192Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 82193Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) (S)
  5. 82428Family d.92.1.12: Zinc peptidase [64335] (1 protein)
  6. 82429Protein Zinc peptidase [64336] (1 species)
  7. 82430Species Fungi (Grifola frondosa) [64337] (4 PDB entries)
  8. 82433Domain d1ge7b_: 1ge7 B: [60462]

Details for d1ge7b_

PDB Entry: 1ge7 (more details), 2 Å

PDB Description: zinc peptidase from grifola frondosa

SCOP Domain Sequences for d1ge7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ge7b_ d.92.1.12 (B:) Zinc peptidase {Fungi (Grifola frondosa)}
tyngcssseqsalaaaasaaqsyvaeslsylqthtaatpryttwfgsyissrhstvlqhy
tdmnsndfssysfdctctaagtfayvypnrfgtvylcgafwkapttgtdsqagtlvhess
hftrnggtkdyaygqaaakslatmdpdkavmnadnheyfsennpaqs

SCOP Domain Coordinates for d1ge7b_:

Click to download the PDB-style file with coordinates for d1ge7b_.
(The format of our PDB-style files is described here.)

Timeline for d1ge7b_: