SCOPe 2.06: Domain d1gdva_: 1gdv A:

Lineage for d1gdva_ (1gdv A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)

7. Species Red alga (Porphyra yezoensis) [TaxId:2788] [63458] (1 PDB entry)

8. Domain d1gdva_: 1gdv A: [60458]
   complexed with hem

Details for d1gdva_

PDB Entry: 1gdv, 1.57 Å

PDB Description: crystal structure of cytochrome c6 from red alga porphyra yezoensis at 1.57 a resolution

PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d1gdva_:

Sequence; same for both SEQRES and ATOM records:

>d1gdva_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Red alga (Porphyra yezoensis) [TaxId: 2788]}
adldngekvfsancaachaggnnaimpdktlkkdvleansmntidaityqvqngknampa
fggrlvdediedaanyvlsqsekgw

Timeline for d1gdva_:

• d1gdva_ first appeared in SCOP 1.57
  
• d1gdva_ appears in SCOPe 2.05
  
• d1gdva_ appears in SCOPe 2.07
  
• d1gdva_ appears in the current release, SCOPe 2.08