Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species) |
Species Red alga (Porphyra yezoensis) [TaxId:2788] [63458] (1 PDB entry) |
Domain d1gdva_: 1gdv A: [60458] complexed with hem |
PDB Entry: 1gdv (more details), 1.57 Å
SCOP Domain Sequences for d1gdva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gdva_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Red alga (Porphyra yezoensis) [TaxId: 2788]} adldngekvfsancaachaggnnaimpdktlkkdvleansmntidaityqvqngknampa fggrlvdediedaanyvlsqsekgw
Timeline for d1gdva_: