SCOPe 2.05: Domain d1gd8d_: 1gd8 D:

Lineage for d1gd8d_ (1gd8 D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
   alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;

4. Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family)
   some topological similarity to ribosomal protein L22
   automatically mapped to Pfam PF01196

5. Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)

6. Protein Prokaryotic ribosomal protein L17 [64265] (4 species)

7. Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries)

8. Domain d1gd8d_: 1gd8 D: [60448]

Details for d1gd8d_

PDB Entry: 1gd8, 2.3 Å

PDB Description: the crystal structure of bacteria-specific l17 ribosomal protein.

PDB Compounds: (D:) 50S ribosomal protein L17

SCOPe Domain Sequences for d1gd8d_:

Sequence; same for both SEQRES and ATOM records:

>d1gd8d_ d.188.1.1 (D:) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

Timeline for d1gd8d_:

• d1gd8d_ first appeared in SCOP 1.57
  
• d1gd8d_ appears in SCOPe 2.04
  
• d1gd8d_ appears in SCOPe 2.06
  
• d1gd8d_ appears in the current release, SCOPe 2.08