Lineage for d1gd8d_ (1gd8 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005595Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 3005596Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
    automatically mapped to Pfam PF01196
  5. 3005597Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 3005598Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 3005636Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries)
  8. 3005640Domain d1gd8d_: 1gd8 D: [60448]

Details for d1gd8d_

PDB Entry: 1gd8 (more details), 2.3 Å

PDB Description: the crystal structure of bacteria-specific l17 ribosomal protein.
PDB Compounds: (D:) 50S ribosomal protein L17

SCOPe Domain Sequences for d1gd8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd8d_ d.188.1.1 (D:) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOPe Domain Coordinates for d1gd8d_:

Click to download the PDB-style file with coordinates for d1gd8d_.
(The format of our PDB-style files is described here.)

Timeline for d1gd8d_: