Lineage for d1gd7c_ (1gd7 C:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 229103Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 229247Family b.40.4.4: Myf domain [50277] (4 proteins)
  6. 229251Protein CsaA [63770] (1 species)
    posesses export-related chaperone and tRNA-binding activities
  7. 229252Species Thermus thermophilus [TaxId:274] [63771] (1 PDB entry)
  8. 229255Domain d1gd7c_: 1gd7 C: [60443]

Details for d1gd7c_

PDB Entry: 1gd7 (more details), 2 Å

PDB Description: crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities.

SCOP Domain Sequences for d1gd7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd7c_ b.40.4.4 (C:) CsaA {Thermus thermophilus}
mtpleafqildlrvgrvlraephekarkpsyklwvdlgplgvkqssaqitelyrpedlvg
rlvvcavnlgakrvagflsevlvlgvpdeagrvvllapdrevplggkvf

SCOP Domain Coordinates for d1gd7c_:

Click to download the PDB-style file with coordinates for d1gd7c_.
(The format of our PDB-style files is described here.)

Timeline for d1gd7c_: