SCOP 1.59: Domain d1gd7b_: 1gd7 B:

Lineage for d1gd7b_ (1gd7 B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families)

5. Family b.40.4.4: Myf domain [50277] (3 proteins)

6. Protein CsaA [63770] (1 species)

7. Species Thermus thermophilus [TaxId:274] [63771] (1 PDB entry)

8. Domain d1gd7b_: 1gd7 B: [60442]

Details for d1gd7b_

PDB Entry: 1gd7, 2 Å

PDB Description: crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities.

SCOP Domain Sequences for d1gd7b_:

Sequence; same for both SEQRES and ATOM records:

>d1gd7b_ b.40.4.4 (B:) CsaA {Thermus thermophilus}
mtpleafqildlrvgrvlraephekarkpsyklwvdlgplgvkqssaqitelyrpedlvg
rlvvcavnlgakrvagflsevlvlgvpdeagrvvllapdrevplggkvf

Timeline for d1gd7b_:

• d1gd7b_ first appeared in SCOP 1.57
  
• d1gd7b_ appears in SCOP 1.61
  
• d1gd7b_ appears in the current release, SCOPe 2.08