Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.4: Myf domain [50277] (7 proteins) |
Protein TRBP111 homolog CsaA [63770] (1 species) possesses export-related chaperone and tRNA-binding activities |
Species Thermus thermophilus [TaxId:274] [63771] (1 PDB entry) |
Domain d1gd7a_: 1gd7 A: [60441] |
PDB Entry: 1gd7 (more details), 2 Å
SCOPe Domain Sequences for d1gd7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gd7a_ b.40.4.4 (A:) TRBP111 homolog CsaA {Thermus thermophilus [TaxId: 274]} mtpleafqildlrvgrvlraephekarkpsyklwvdlgplgvkqssaqitelyrpedlvg rlvvcavnlgakrvagflsevlvlgvpdeagrvvllapdrevplggkvf
Timeline for d1gd7a_: