Lineage for d1gcqb_ (1gcq B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392660Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 2392670Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)
  8. 2392672Domain d1gcqb_: 1gcq B: [60435]
    Other proteins in same PDB: d1gcqa2, d1gcqc1, d1gcqc2
    C-terminal domain
    complexed with mrd

Details for d1gcqb_

PDB Entry: 1gcq (more details), 1.68 Å

PDB Description: crystal structure of vav and grb2 sh3 domains
PDB Compounds: (B:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d1gcqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcqb_ b.34.2.1 (B:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
tyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr

SCOPe Domain Coordinates for d1gcqb_:

Click to download the PDB-style file with coordinates for d1gcqb_.
(The format of our PDB-style files is described here.)

Timeline for d1gcqb_: