SCOPe 2.07: Domain d1g9oa1: 1g9o A:11-99

Lineage for d1g9oa1 (1g9o A:11-99)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Na+/H+ exchanger regulatory factor, NHERF [63754] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63755] (4 PDB entries)

8. Domain d1g9oa1: 1g9o A:11-99 [60400]
   Other proteins in same PDB: d1g9oa2
   first PDZ domain

Details for d1g9oa1

PDB Entry: 1g9o, 1.5 Å

PDB Description: first pdz domain of the human na+/h+ exchanger regulatory factor

PDB Compounds: (A:) nhe-rf

SCOPe Domain Sequences for d1g9oa1:

Sequence; same for both SEQRES and ATOM records:

>d1g9oa1 b.36.1.1 (A:11-99) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]}
lprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenveke
thqqvvsriraalnavrllvvdpetdeql

Timeline for d1g9oa1:

• d1g9oa1 first appeared in SCOP 1.57, called d1g9oa_
  
• d1g9oa1 appears in SCOPe 2.06
  
• d1g9oa1 appears in the current release, SCOPe 2.08