SCOPe 2.08: Domain d1g9la1: 1g9l A:6-144

Lineage for d1g9la1 (1g9l A:6-144)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.144: PABP domain-like [63569] (2 superfamilies)
   4 helices; an orthogonal array

4. Superfamily a.144.1: PABC (PABP) domain [63570] (2 families)

5. Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)

6. Protein poly(A) binding protein [63572] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63573] (3 PDB entries)

8. Domain d1g9la1: 1g9l A:6-144 [60399]
   Other proteins in same PDB: d1g9la2
   has additional insertions and/or extensions that are not grouped together

Details for d1g9la1

PDB Entry: 1g9l

PDB Description: solution structure of the pabc domain of human poly(a) binding protein

PDB Compounds: (A:) polyadenylate-binding protein 1

SCOPe Domain Sequences for d1g9la1:

Sequence; same for both SEQRES and ATOM records:

>d1g9la1 a.144.1.1 (A:6-144) poly(A) binding protein {Human (Homo sapiens) [TaxId: 9606]}
aaaatpavrtvpqykyaagvrnpqqhlnaqpqvtmqqpavhvqgqepltasmlasappqe
qkqmlgerlfpliqamhptlagkitgmlleidnsellhmlespeslrskvdeavavlqah
qakeaaqkavnsatgvptv

Timeline for d1g9la1:

• d1g9la1 first appeared in SCOP 1.57, called d1g9la_
  
• d1g9la1 appears in SCOPe 2.07