Lineage for d1g8mb1 (1g8m B:4-200)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68790Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
  4. 68791Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
  5. 68841Family c.24.1.3: Inosicase [63971] (1 protein)
  6. 68842Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (1 species)
  7. 68843Species Chicken (Gallus gallus) [TaxId:9031] [63973] (1 PDB entry)
  8. 68845Domain d1g8mb1: 1g8m B:4-200 [60373]
    Other proteins in same PDB: d1g8ma2, d1g8mb2

Details for d1g8mb1

PDB Entry: 1g8m (more details), 1.75 Å

PDB Description: crystal structure of avian atic, a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis at 1.75 ang. resolution

SCOP Domain Sequences for d1g8mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8mb1 c.24.1.3 (B:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus)}
rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg
grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave
kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht
aqydaaisdyfrkeysk

SCOP Domain Coordinates for d1g8mb1:

Click to download the PDB-style file with coordinates for d1g8mb1.
(The format of our PDB-style files is described here.)

Timeline for d1g8mb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g8mb2