Lineage for d1g8gb2 (1g8g B:169-389)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242042Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 242043Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 242231Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein)
  6. 242232Protein ATP sulfurylase central domain [63980] (3 species)
  7. 242233Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63981] (6 PDB entries)
  8. 242237Domain d1g8gb2: 1g8g B:169-389 [60355]
    Other proteins in same PDB: d1g8ga1, d1g8ga3, d1g8gb1, d1g8gb3
    complexed with acy, adx, ca, cd, mg, na, trs

Details for d1g8gb2

PDB Entry: 1g8g (more details), 2.6 Å

PDB Description: atp sulfurylase from s. cerevisiae: the binary product complex with aps

SCOP Domain Sequences for d1g8gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8gb2 c.26.1.5 (B:169-389) ATP sulfurylase central domain {Baker's yeast (Saccharomyces cerevisiae)}
ypglrktpaqlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvglt
kpgdidhhtrvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfiv
grdhagpgknskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidt
tktrtlnisgtelrrrlrvggeipewfsypevvkilresnp

SCOP Domain Coordinates for d1g8gb2:

Click to download the PDB-style file with coordinates for d1g8gb2.
(The format of our PDB-style files is described here.)

Timeline for d1g8gb2: