Lineage for d1g8ga2 (1g8g A:169-389)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178484Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 178485Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 178615Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein)
  6. 178616Protein ATP sulfurylase central domain [63980] (3 species)
  7. 178617Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63981] (6 PDB entries)
  8. 178620Domain d1g8ga2: 1g8g A:169-389 [60352]
    Other proteins in same PDB: d1g8ga1, d1g8ga3, d1g8gb1, d1g8gb3

Details for d1g8ga2

PDB Entry: 1g8g (more details), 2.6 Å

PDB Description: atp sulfurylase from s. cerevisiae: the binary product complex with aps

SCOP Domain Sequences for d1g8ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8ga2 c.26.1.5 (A:169-389) ATP sulfurylase central domain {Baker's yeast (Saccharomyces cerevisiae)}
ypglrktpaqlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvglt
kpgdidhhtrvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfiv
grdhagpgknskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidt
tktrtlnisgtelrrrlrvggeipewfsypevvkilresnp

SCOP Domain Coordinates for d1g8ga2:

Click to download the PDB-style file with coordinates for d1g8ga2.
(The format of our PDB-style files is described here.)

Timeline for d1g8ga2: