SCOP 1.69: Domain d1g8fa1: 1g8f A:2-168

Lineage for d1g8fa1 (1g8f A:2-168)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (4 families)

5. Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
   contains extra structures; some similarity to the PK beta-barrel domain

6. Protein ATP sulfurylase N-terminal domain [63802] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (8 PDB entries)

8. Domain d1g8fa1: 1g8f A:2-168 [60348]
   Other proteins in same PDB: d1g8fa2, d1g8fa3

Details for d1g8fa1

PDB Entry: 1g8f, 1.95 Å

PDB Description: atp sulfurylase from s. cerevisiae

SCOP Domain Sequences for d1g8fa1:

Sequence; same for both SEQRES and ATOM records:

>d1g8fa1 b.122.1.3 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

Timeline for d1g8fa1:

• d1g8fa1 first appeared in SCOP 1.57
  
• d1g8fa1 appears in SCOP 1.67
  
• d1g8fa1 appears in SCOP 1.71
  
• d1g8fa1 appears in the current release, SCOPe 2.08