Lineage for d1g84a_ (1g84 A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) 
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) 
Species C epsilon2 domain from IgE (human) [63660] (1 PDB entry) 
Domain d1g84a_: 1g84 A: [60345]
Details for d1g84a_
PDB Entry: 1g84 (more details)
PDB Description: the solution structure of the c epsilon2 domain from ige
SCOP Domain Sequences for d1g84a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g84a_ b.1.1.2 (A:) Immunoglobulin (constant domains of L and H chains) {C epsilon2 domain from IgE (human)}
srdftpptvkilqsssdggghfpptiqllclvsgytpgtinitwledgqvmdvdlstast
tqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkksa
SCOP Domain Coordinates for d1g84a_:
Click to download the PDB-style file with coordinates for d1g84a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g84a_:
- d1g84a_ first appeared in SCOP 1.57
- d1g84a_ appears in SCOP 1.61
- d1g84a_ appears in the current release, SCOPe 2.08
View in 3D