Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species C epsilon2 domain from IgE (human) [63660] (1 PDB entry) |
Domain d1g84a_: 1g84 A: [60345] |
PDB Entry: 1g84 (more details)
SCOP Domain Sequences for d1g84a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g84a_ b.1.1.2 (A:) Immunoglobulin (constant domains of L and H chains) {C epsilon2 domain from IgE (human)} srdftpptvkilqsssdggghfpptiqllclvsgytpgtinitwledgqvmdvdlstast tqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkksa
Timeline for d1g84a_: