Lineage for d1g7oa1 (1g7o A:76-215)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538429Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 538430Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 538431Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 538828Protein Glutaredoxin 2 [63557] (1 species)
    similar to class zeta enzymes
  7. 538829Species Escherichia coli [TaxId:562] [63558] (1 PDB entry)
  8. 538830Domain d1g7oa1: 1g7o A:76-215 [60332]
    Other proteins in same PDB: d1g7oa2

Details for d1g7oa1

PDB Entry: 1g7o (more details)

PDB Description: nmr solution structure of reduced e. coli glutaredoxin 2
PDB Compounds: (A:)

SCOP Domain Sequences for d1g7oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli}
plltgkrspaieewlrkvngyanklllprfaksafdefstpaarkyfvdkkeasagnfad
llahsdgliknisddlraldklivkpnavngelseddiqlfpllrnltlvaginwpsrva
dyrdnmakqtqinllssmai

SCOP Domain Coordinates for d1g7oa1:

Click to download the PDB-style file with coordinates for d1g7oa1.
(The format of our PDB-style files is described here.)

Timeline for d1g7oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g7oa2